PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco029104.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WOX
Protein Properties Length: 425aa    MW: 45714.5 Da    PI: 6.4091
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco029104.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.68.9e-1854114257
                  T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                  ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  Aco029104.1  54 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 114
                  89*****************99*************************************995 PP

2Wus_type_Homeobox1123.2e-3653115264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
        Aco029104.1  53 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 115
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-741113IPR009057Homeodomain-like
PROSITE profilePS5007110.51150115IPR001356Homeobox domain
SuperFamilySSF466894.02E-1250118IPR009057Homeodomain-like
SMARTSM003896.8E-952119IPR001356Homeobox domain
CDDcd000862.40E-853115No hitNo description
PfamPF000462.3E-1554114IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MASSNRHWPS LFKSKPCNTH QQWQHDINSS ALLSGACHKS PYSSGCEERS PEPKPRWNPK  60
PEQIRILEAI FNSGMVNPPR DEIRKIRAQL QEYGQVGDAN VFYWFQNRKS RSKHKLRHLH  120
PHPPAASSRS RSQSQSTASS TSSDKSSGAS DKTPIASVAS VALTTVTDRP TPPPPQMTNQ  180
LEPIGHVYYD FGAAAATAEP FFLQGGLGLW SELMMEQEEG EEGCKVNSTA NKEEEEEEEE  240
EEDGEGKGNK NMELHHFYDI DVATSASNAS ASAAVTSAAA AAASAALAGG GATPVAPSPA  300
GVASPVNEIQ QVSGGGATAI AAAVARSTVF INEVAFEVVV SPLNVREAFG EHAILLHASG  360
HPVLTDEFGV TLQPLQHGAS YYLYGYVWAT SAQRKNRPKT AAGRQAAIRR TYRHSQPDQT  420
EVFD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0037602e-63AP003760.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBb0063G05.
GenBankAP0149572e-63AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126092e-63CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010918996.11e-130PREDICTED: WUSCHEL-related homeobox 8
TrEMBLA0A061GG541e-104A0A061GG54_THECC; Homeobox-3, putative
STRINGGLYMA10G08030.12e-99(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26663470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.14e-60homeobox-3